SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3R633 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3R633
Domain Number 1 Region: 5-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.31e-36
Family Thioltransferase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1R3R633
Sequence length 230
Comment (tr|A0A1R3R633|A0A1R3R633_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOF89940.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_410504 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTNFNIQIISDTVCPWCYVGFRRLSRAIAIHKTAHPTDTFTLNWHAFYLNPASPSFPGLD
KTEFYKSKFGADRATAIFGRLAAVGQADGIAFSFGGRTGNTRDSHRLLWYAGQREKEGTV
TATTEEGTVGGLQTRVAEQLFRAYFEEEKNITDREVLVQAAVGAGLERAAVEQLLGSEEG
GKEVDLEAERARRQLVTGVPYYMVQGQYAVEGADEPDTFLEVFEQVKKSA
Download sequence
Identical sequences A0A1R3R633
jgi|Aspca1|33752|fgenesh1_pg.00769_#_3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]