SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3RAF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3RAF8
Domain Number 1 Region: 29-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-31
Family Thioltransferase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R3RAF8
Sequence length 139
Comment (tr|A0A1R3RAF8|A0A1R3RAF8_ASPC5) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_211279 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MELSRILLAIAVYLVIRLVRSRFSSNNTGSTMSHGKVIEVDNPVIFKALTSSGPVVVDFF
ATWCGPCKAVAPVVGKLSETYTNVRFIQVDVDKVRSVAQELEVRAMPTFVLFKDGQLQEK
RVVGGNMKELEEAIKSITA
Download sequence
Identical sequences A0A1R3RAF8
jgi|Aspca1|16939|e_gw1.00795.190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]