SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3RGW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3RGW0
Domain Number 1 Region: 188-339
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-35
Family UAS domain 0.0001
Further Details:      
 
Domain Number 2 Region: 395-508
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000878
Family UBX domain 0.023
Further Details:      
 
Domain Number 3 Region: 4-43
Classification Level Classification E-value
Superfamily UBA-like 0.0000000425
Family TAP-C domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1R3RGW0
Sequence length 513
Comment (tr|A0A1R3RGW0|A0A1R3RGW0_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOF93717.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_132058 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MDGDVVAQFTEITGSKPELAAQYLQLADFNIEQAVQLFFENGGAPLTDEPLPSTSTPQQS
SHADGGVVHVDSDDDITIDETRSAPRNHPSHGTTFEDDAAMARRLQEEMYGGRDAEEGVR
APMARTTETLVGPEADFDDGDMHASILGQLRARQQRNNRPGIFNQRDTSIWTGDDETSQR
ERLAAATGGASEASNKSNMLAEMYRPPFDIMSRLPWDLARQEGRDNERWLMVNIQDPSVF
DCQVLNRDLWKDPAVKETVKEHFIFMQYSKDDPRAGPYLQYYFQASDVSDNYPHIAIVDP
RTGEQMKVWSGPPVIKASDFLMQLHEFLDRYSLKHNVRNPVAKRKPEMKEKSIDAMTEEE
MLEMAMRNSLGDEASQPPKVEDPDDLTRSTEDVKGKGRAIDEDVGMEETEGPEQNAFSSI
PDDRFHTEPPADPATTTRIQFRHPSGRVIRRFALSDPVQRIYEWLKAEPPLADKAGVEFE
LNAMGRNLIDSLGQTIADAGLKNGTVMIGYLEE
Download sequence
Identical sequences A0A1R3RGW0
jgi|Aspca1|24171|fgenesh1_pm.00626_#_66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]