SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3RZG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3RZG5
Domain Number 1 Region: 23-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000153
Family Glutathione peroxidase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R3RZG5
Sequence length 199
Comment (tr|A0A1R3RZG5|A0A1R3RZG5_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOF99905.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_203727 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTFSQEAASWFSPSPVELSPTPQPGQQAPSCAQLPFPAHNGRPTIVTFLRHCGCPVAEAT
FLDLRAAAEKYPEINFVAVSHSDQPSTDRWLESVGGAGEAEANPVAVIVDAERKIYAQWG
LGLASWSHVLSPNGLLSIWKLGRERGIWNRPTESGSRWQLSGSWAVDAEGIVRWGRPVAR
VDELMDLGQAIEILHGPRI
Download sequence
Identical sequences A0A1R3RZG5
jgi|Aspca1|17638|e_gw1.00866.713.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]