SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3S1W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3S1W3
Domain Number 1 Region: 18-173,207-231,328-417
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.8e-49
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 466-645
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-48
Family Glutathione peroxidase-like 0.0000904
Further Details:      
 
Domain Number 3 Region: 234-334
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.61e-27
Family PHBH-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1R3S1W3
Sequence length 652
Comment (tr|A0A1R3S1W3|A0A1R3S1W3_ASPC5) Uncharacterized protein {ECO:0000313|EMBL:OOG00719.1} KW=Complete proteome; Reference proteome OX=602072 OS=Aspergillus carbonarius (strain ITEM 5010). GN=ASPCADRAFT_392808 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MCKSSVSDCPLLLTISSLIIGAGPSGLAVAYWMAQYGINARIIDKRGTKLFRGHADGLRS
RTLELFDSMGFAHRVTEEGYHAAAFMFWRPDGHGGLQRTGQQRSTIHDSSPYRMALLTQG
RIERFFLDVIRGTSSLDVERGVVGESLSYDESLEKDPQAYPITVQLRTLSEEEATPAPNP
GICPYQPAPDDREDLIQKRKHKVGTVETIRAKYLIGCDGAHSWTRKQLDIPFEGSHTDHI
WGVMDVVPITDFPDIRWPSSIDGPHGHLLMITREGNMVRFYVPLQEDDEVVADSFDRSAV
TLDMLRERVKKIMAPFYFDFKICHWWAAYQVGRRLTPTVNKGRMYLVGDAVHTHSPKIGL
GMNMSIQDGFNLGWKLGLVLKGIASPTILETYASERHQLAQMVLDFDKKWASFFLRKEKQ
VKQELEASPEEPDDIQAAMREAFIENELFAEGHVTFYKSSPLVHKGSTAMAKNLVAGERF
PAALIRNQADGQPWWTTRLLKSDGRFRILLLAGDVRLQDRQSCMSTLSKSLTELLKRFTP
SEQKPDSVIEVKAIHSAPLDQVELRDFPPVVRQFDEDEGWDYTKVWSDSECFWDQQCKGN
AYEIWGVDRSRGAMVVLRPDQYVGWMGELDDVAGVTEYFEGILCENKPSPVL
Download sequence
Identical sequences A0A1R3S1W3
jgi|Aspca1|11322|e_gw1.00083.226.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]