SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S0UL39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S0UL39
Domain Number 1 Region: 130-258
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-16
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S0UL39
Sequence length 298
Comment (tr|A0A1S0UL39|A0A1S0UL39_LOALO) Uncharacterized protein {ECO:0000313|EMBL:EJD76088.1} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_16896 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MTKLFIFTFFNIWTIAPSKCFMRLSSSEELHGNSCGDTSSPIFAQTTSSTFYSPNHSAST
SVHVPATTHRIQRFISFFSSGDTQTKHWETTSSPTTVRFPSRRRLKRSTTATTTPISASL
LATPIPLGDVQKQGQLMHQEMAMGEPVKNDRHKWTTYWVVLHGTKLYLCCQLSSHINDET
HEKLLNIPSDARQIDLKSAIVDIAYEYCRSKDNKKAHVFRVITQQQTEHHFQTYCEDDML
KWIEIIRFASSNLISSQSDHGTVSTGVTSNIDLSSNVPNNWSTVTKFQSDNNSSDQCK
Download sequence
Identical sequences A0A1S0UL39
LOAG_16896T0 XP_020306909.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]