SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S2ZQ81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S2ZQ81
Domain Number 1 Region: 1121-1297
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00069
Further Details:      
 
Domain Number 2 Region: 683-798
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 451-570
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-26
Family Pleckstrin-homology domain (PH domain) 0.0000158
Further Details:      
 
Domain Number 4 Region: 876-1037
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 1430-1566
Classification Level Classification E-value
Superfamily PH domain-like 6.94e-21
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 6 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.51e-16
Family SAM (sterile alpha motif) domain 0.0000678
Further Details:      
 
Domain Number 7 Region: 584-676
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000503
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 8 Region: 1014-1107
Classification Level Classification E-value
Superfamily PH domain-like 0.000000115
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S2ZQ81
Sequence length 1702
Comment (tr|A0A1S2ZQ81|A0A1S2ZQ81_ERIEU) arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 {ECO:0000313|RefSeq:XP_007522859.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=ARAP2 OC=Erinaceinae; Erinaceus.
Sequence
MSSASEVNLDIKDFLMSINLDQYVLHFRDFGFNTVKDCVTINDSVLHQIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKMKSDKTLKDPRILSSDQNTCLQLLDSSGIQTPSPVHSD
SVTESLDPGDISGENSPSLKSDDKFFPTHNFPVPEEPHLSLGSCQDSSLDSKNIKVESLT
TEKNVNCTTEEQRGNIDFISENTSQDSSADPHCFSSFGCPKSEGNSGSGTNGLLESTSTP
PFFQFQGEMVVNDLYVPSSPILTPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGTSGSY
FRERRNGATSAGKPVTQQNSNEENSSSIFPYGETFLFQRLENSKKRCIKNEFWTHDEPLK
GEATTERNSFIVKSSIYDNRQESISEDKVEDIWIPREDKNNIPVESTSESEYSTVEECFQ
SLRRKNSKSSKSRTQKSLNVDPVNRHTYPLSSTSGNADSSVISSNAISPYACFYGSSARK
VKSGWLDKLSPQGKRMFQKRWVKFDGLSVSYYNNEKEKYSKGIIPLSAISSVRVQGDNKF
EVITTQRTFVFRAEKEEERNDWISILLNALKSQSLSSQSQAALVPDKCGNLELRGYKAKI
YTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRSAKQSFEIITPYRSFSFTAES
EKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKC
AGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLKKDEELHMDSPV
EKRKKFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATG
DPMHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHCEGGLNQESPQSTFLCDFLYQSP
SAAPKLSSEKKVLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVVCLAVHKEDFCL
NTGPIFTFEIYLPSERAFLFGAETSQTQRKWTEAIVKHFVPFVAENLTEADYNLIGQLYY
KDCHALDQWRKGWFAMHKSSLHFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKVDVLLL
VEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGDALRDQQLSKNDVPIIVNSCIAFVTQYG
LGCKYIYQKTGDPLHINELLESFKKDARSFKLRAGKHQLDDVTSVLKKFLNDIDDALLTK
ELYPYWISALDTQDDKERMKKYSAFIRTLPGVNRATLAAVIEHLYRVQKCSEINHMNAHN
LALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVS
QAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPSKDDIWATFEVIENE
ELERPLHYTENVLEQVLRWSSLSEPGSAYLVVKRFLTIDTIRRHNERRAQESIKEGVLKI
KEEPSKILSGNKFQDRYFVLRDGCLFLYKDQKSTKHDKMFSLNSMKFFLGVKKKMKPPTS
WGLTAYFEKHHWHLCCDSLQTQTEWMASIFIAQHENDIWPPAGKERKRSITKNPKIGGLP
LIPIQQERNASQARRNLESTRAELDRLRLSDKHCPEYEDQTLKEKASLVAHCLEHKDDKL
RNRARKHRSFNCLEDTEAEVFYSRHKGLKTLKKTEDKSNRTTLDSDNKLPSNVIEELSAV
LQRSRILSKELQGEKILQKEIK
Download sequence
Identical sequences A0A1S2ZQ81
XP_007522859.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]