SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3A0B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3A0B8
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 34-77
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000255
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3A0B8
Sequence length 264
Comment (tr|A0A1S3A0B8|A0A1S3A0B8_ERIEU) somatomedin-B and thrombospondin type-1 domain-containing protein {ECO:0000313|RefSeq:XP_007527361.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=SBSPON OC=Erinaceinae; Erinaceus.
Sequence
MRLLWMALCALARLGPGVLAGCTEAGRCCPGRDPTCFAQGWRLDRVYGTCFCDQACRLAG
DCCFDYARACPARPCIVGEWSSWSGCADQCRPTTRVRRRSVKQEPQNGGEPCPPLEERAG
CLEYSTPQGQDCAHSFVPAFITTSAFNKERTRQAASPHWSTDTEDTGYCMEFKTESLTHH
CAVANRPLTQWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences A0A1S3A0B8
XP_007527361.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]