SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3AS04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3AS04
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 2 Region: 251-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 208-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 415-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3AS04
Sequence length 760
Comment (tr|A0A1S3AS04|A0A1S3AS04_ERIEU) low-density lipoprotein receptor-related protein 3 isoform X2 {ECO:0000313|RefSeq:XP_007539532.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=LRP3 OC=Erinaceinae; Erinaceus.
Sequence
MEKRAVAGLEGAPGARAQLAVVCLVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
SWPLNYPPGTNCSWYIQGDRGDMITISFHNFDVEESHQCSLDWLMLGPAAPPRQEALRLC
GSAIPAAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSCQADEFRCDNGKCLP
GSWQCNTVDECGDGSDEGNCSAPVSEPPHSLCPGGTFPCSGARSTRCLPAERRCDGSQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSGGDVEAGDPGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAAHTSQTVLGDGLLQPVPGGAPDTPAPQTDTNSS
GTAPGHVPEVGPSGLPASGQRDPQGQQGNKDRKVCRAPRGASPAPVDTACTAQDPHSPTP
AASGTPGPQPPEPVAVCRSPPPPSSPTLEASDDDEALLVC
Download sequence
Identical sequences A0A1S3AS04
XP_007539532.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]