SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3B542 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3B542
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-30
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 2 Region: 192-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000324
Family Calsequestrin 0.074
Further Details:      
 
Domain Number 3 Region: 438-564
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000032
Family Calsequestrin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3B542
Sequence length 573
Comment (tr|A0A1S3B542|A0A1S3B542_CUCME) dnaJ protein ERDJ3A {ECO:0000313|RefSeq:XP_008442391.1} KW=Complete proteome; Reference proteome OX=3656 OS=Cucumis melo (Muskmelon). GN=LOC103486271 OC=Benincaseae; Cucumis.
Sequence
MGTRLASIILVLAFLFLFRLSLEAKTMDPYKVLGVERNASQREIQKAFHKLSLQYHPDKN
KKKGAQQKFEEINNAYEILSDEEKRKNFDMYGDEKGAPGFGAGPSGDQGGGYTFFTNGGG
RQGQQPFGPGQWQSTGGQGGSQSFSFSFGGPSGSNPFGFGMEDIFSNFFGGGFKDKGSFG
GHSKAQSGPKSSSSIKVINKQLLKKEIVDQGMTWLLFPTTSSLKGVDHVQSIIEEVASTL
QGALKVGRIDCDSESSFCKDLGIYPHRTPRIFVYSYIKSNEGSLVEYSGDIDVKSLKGFC
QEHFPRFSQRVNLKQFDFSSSNRGRLPTLMLLSTKKETPVIWRVLSGLFRKLFNFYDAEV
TDASDPSIKKLGVDALPAIVGWLSNGERHVLRTGINVKDLKSAIDDLSNLLNGFEKKNRK
AASRPTSKTQSDSVENQIPLLTGSNFDSVCGEKTPVCVIGAFRSSKARNKLESILKMVSQ
KTLSRRQNSTPGSKETISYALVDATKQVSFLNAFVDSAGFKSSDKILIAYKRRKGKFAAY
LGEITEEEVEKFIGSVLNGDVTFTNTRQKPILK
Download sequence
Identical sequences A0A1S3B542
XP_008442391.1.74646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]