SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3BQ69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3BQ69
Domain Number 1 Region: 163-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000541
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 275-305
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000628
Family CCCH zinc finger 0.002
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 38-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000693
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3BQ69
Sequence length 309
Comment (tr|A0A1S3BQ69|A0A1S3BQ69_CUCME) zinc finger CCCH domain-containing protein 14-like {ECO:0000313|RefSeq:XP_008451117.1} KW=Complete proteome; Reference proteome OX=3656 OS=Cucumis melo (Muskmelon). GN=LOC103492494 OC=Benincaseae; Cucumis.
Sequence
MDLDGARKRERTETALNGNGGFKKSKPEMDSLSTGLGSKSRPCTKFFSTSGCPFGEGCHF
AHYVPGGVKSISQMISPALPPGIRNPAPPQSFPDGVPPAVKTRLCNKFNSAEGCRFGDKC
YYAHGEWELGRPNPPQDHGGMGPGPMQQPRMGGGWNAPPPPPNHGPAASFGASATAKISV
DASLAGPIIGKNGINSKNICRMTGARLSIKEHESDPNLKNIELEGTFDQINLASSMVREL
IANVGAASANNAMKQHQHQHQHHSGMQQSSGSANNFKTKLCANFTKGACTFRERCHFAHG
ESELRKPGM
Download sequence
Identical sequences A0A1S3BQ69
XP_008451117.1.74646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]