SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3DDW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3DDW4
Domain Number 1 Region: 385-604
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-49
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 133-215
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000829
Family DNA ligase 0.054
Further Details:      
 
Domain Number 3 Region: 195-316
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000698
Family DNA topoisomerase II binding protein 1, TopBP1 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3DDW4
Sequence length 820
Comment (tr|A0A1S3DDW4|A0A1S3DDW4_DIACI) protein ECT2-like {ECO:0000313|RefSeq:XP_008479888.1, ECO:0000313|RefSeq:XP_008479893.1} KW=Complete proteome; Reference proteome OX=121845 OS=Diaphorina citri (Asian citrus psyllid). GN=LOC103516681 OC=Psylloidea; Liviidae; Diaphorina.
Sequence
MSSPGGTTAIQSEPMEVDCSIMQPSEETEEKDTEPGMPCQICVCSNVDQTETFKKALASF
NVPVVLVEDPDYFVHAKFDGPIIIVTSEFTNNFLRFHKPPQSRILGPTALIEMSIKVENL
SIPLRTRIRPLFCHSMQNIVICITGFRNKQETMKLIDITKHMGGKLRKEMNYQVTHLIAN
CVSGEKYKYAMGFRVPVLTKEFVLSAWEKRYDVNFKADEPSFMNQYKLKLFQGAKVNFFG
FSEEDEEQLQELLLSNGGKPSLSSDEPLTTHVVVDDSKVTCMPNVPCTSTYVVKARWFWM
SIQNSECADESKYLFGKNFRTPDRAAKRKRLMEVVEEPHSSPRKSRKKRTSDIDGTPRYS
CGSLLDYTTSPDNFLATDESDVMIKGNSPRHQVFKELCQTESNYVNVLRVLIEHFKNPLE
EKLNTNECILNQAEMKIIFGDLCPIFDTHKDLLKDLKYLEQNYSDSVSIGEVFVKHCTAF
KKVYPPFINFFQDSNSLLKEKEKNSRFLAFLKLCYMNLRDLGLPEIDKQTLPDLLIRPVQ
RLGSISLLLNDILKNTSKSSTDHQKLSEALDGIRTVMTFLNENKQRQDNQRSLFDIYQDI
ENCPPQLINSHRSFVLKCDVIELSNMLSHRGDCITLFLFTDVVEVCKKRSKYVNVLKSPN
TSKMSLSTYKTQAKHPIDKTYKHIKLLSMTSIKKVYNVEDEAHDNDRQIFALRCRGSDEV
IETTYSFNIIDDTLDKMSFLRELCRQASAVYCINFDKFLEDISLANASSFNIETHESSNS
TLGRAIKFASKQVGRTLSLNRTPSTLRKVMSSMKVRVADT
Download sequence
Identical sequences A0A1S3DDW4
XP_008479888.1.36046 XP_008479893.1.36046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]