SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3ELR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3ELR5
Domain Number 1 Region: 73-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.37e-38
Family Ankyrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3ELR5
Sequence length 239
Comment (tr|A0A1S3ELR5|A0A1S3ELR5_DIPOR) ankyrin repeat domain-containing protein 49 {ECO:0000313|RefSeq:XP_012864890.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Ankrd49 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MEKEKINHDEKTDAENSPDFSDHFNQLELLKTHGHLIPTGTQSLWLGNSDEDEEQDEKSE
EWYQLQEKKMEKDPSKLLLWAAENNRITTVQRLLSEKAAHVNTRDDDEYTPLHRAAYSGH
LDIVRELVAQGADIHAITVDGWTALHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSKDTLELLLMNRYIKPGLRNNLEETAFDIARRTSIYHYLFEVVESCTNSSPKS
Download sequence
Identical sequences A0A1S3ELR5
ENSDORP00000012571 XP_012864890.1.60039 ENSDORP00000012571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]