SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3EMS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3EMS7
Domain Number 1 Region: 37-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-59
Family Ankyrin repeat 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3EMS7
Sequence length 361
Comment (tr|A0A1S3EMS7|A0A1S3EMS7_DIPOR) ankyrin repeat domain-containing protein 16 {ECO:0000313|RefSeq:XP_012864782.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Ankrd16 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MAPPGDPRRLCRLVQEGRLRALQEELRAAGGCQGPAGDTLLHCASRHGRLDILAYLAETC
GMDIEAANRDYKRPLHEAASMGHRNCVGYLLDRGAAVDCLKKGDWTPLMMACTRKNLEVI
QALVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPDAWKTESKIRRTPLHTAAM
HGCLEAVKVLLKRCQYEPDCRDNCGVTPFMDAIQCGHVEVARLLLEKHQACSSAEDSLGA
QALHRAAVTGQDEAIRFLVSDLGIDVDVRATTTHHTALHYAAKEGHTSTLETLLSLGADI
NAKDERNRSALHLACAGQHLACAQFLLRSGLKDSEDITGTLALQLTQNVDILQGFDPCAT
T
Download sequence
Identical sequences A0A1S3EMS7
XP_012864782.1.60039 ENSDORP00000000524 ENSDORP00000000524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]