SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3ER08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3ER08
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.02e-22
Family Pyrin domain, PYD 0.000038
Further Details:      
 
Domain Number 2 Region: 110-196
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-20
Family Caspase recruitment domain, CARD 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3ER08
Sequence length 198
Comment (tr|A0A1S3ER08|A0A1S3ER08_DIPOR) apoptosis-associated speck-like protein containing a CARD {ECO:0000313|RefSeq:XP_012866831.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=LOC105981993 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MGSARDAILDALENLTAEELKRFKLKLLSVPLRPGFGRIPRGPLQSMDAIDLTDKLVSYY
MDSYGPELTATVLREMGMQALAEQLGDRLRAPSAQPAALKASLQMAATPEPSRLHFVDQH
RRALISRVTDVDGLLDALFDDKVLTEEQYQAVRAETTNPTKMRKLYSFMPAWDLKCKELF
LQALRDIQPYLVDDLEKH
Download sequence
Identical sequences A0A1S3ER08
XP_012866831.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]