SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3EU22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3EU22
Domain Number 1 Region: 372-479
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.57e-18
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1830-1910
Classification Level Classification E-value
Superfamily E set domains 8.87e-16
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 
Domain Number 3 Region: 1915-1997
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000196
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1156-1234
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000222
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 5 Region: 271-362
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 6 Region: 1239-1319
Classification Level Classification E-value
Superfamily E set domains 0.000000000000306
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 7 Region: 3284-3304,3344-3523
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000314
Family Galacturonase 0.055
Further Details:      
 
Domain Number 8 Region: 1658-1745
Classification Level Classification E-value
Superfamily E set domains 0.000000000000535
Family Other IPT/TIG domains 0.046
Further Details:      
 
Domain Number 9 Region: 2000-2085
Classification Level Classification E-value
Superfamily E set domains 0.0000000000012
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.034
Further Details:      
 
Domain Number 10 Region: 2089-2174
Classification Level Classification E-value
Superfamily E set domains 0.00000000000121
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 11 Region: 1065-1140
Classification Level Classification E-value
Superfamily E set domains 0.00000000000484
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 12 Region: 1563-1640
Classification Level Classification E-value
Superfamily E set domains 0.000000000238
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 13 Region: 32-124
Classification Level Classification E-value
Superfamily E set domains 0.00000000992
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 14 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.0000000121
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Domain Number 15 Region: 1331-1389
Classification Level Classification E-value
Superfamily E set domains 0.0000000191
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 16 Region: 1748-1820
Classification Level Classification E-value
Superfamily E set domains 0.0000000373
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 17 Region: 1406-1503
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000131
Family Plastocyanin/azurin-like 0.079
Further Details:      
 
Domain Number 18 Region: 2365-2401,2452-2680
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000112
Family Galacturonase 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3EU22
Sequence length 4249
Comment (tr|A0A1S3EU22|A0A1S3EU22_DIPOR) fibrocystin-L {ECO:0000313|RefSeq:XP_012867923.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Pkhd1l1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MGHLWLLETWGLCWLLLCAADLRTESSKTIPKVTEVMPKYGSINGATRLTIKGEGFSQAN
QFNYGVDNTELGNSVQLVSSFQSITCDVEKDSSHSTQITCYTRAMPEDSYTVRVSVDGVP
IAENHTCRGRSGSWACSFNTKSFRTPTIRNITPLSGTPGTLITIQGRIFTDVYGSNTAVS
SNGRNVRILRVYIGGMPCELLIPQSDDLYGLKLDHPSGDMGSMICKITGTYIGHHNVSFI
LDSDYGRSFPENMTYFVSSLNKISMFQTYAEITSISPSKGSIQGGTVLTINGQFFDQTDL
PVKVLVGGQSCDVLNVTENRIYCKTPPLPPVLKSLYPGGRGLKLEVWNNSRPVHLEEIFE
YNEGTLGYMGATWVDSASYVWPLEQDTFVARFSGFLVPPDSDVYRFYIKGDDRYAIYFSQ
TGLPEDKVRIAYHSANSNSYFSSPSQRSDDIHLHKGKEYYIEILLQEHKLSAFVDVGLYQ
YKTVYSEQQTGDAVNEEQVIKSQSTIIQEVQVITLENWETTNATHEVQKITVTSSCVEAS
SCSLYQYRLMYGKEKTVLLAADASDFILQSALNDLWSIKPDTVQVKRTQNLQSYSYIITF
LSTRGDFDLLGYELFAGNNVTLDITEQTKGKPSLETFTLNWDGVASMPLNPRSSEVEFQV
AVEEMVSTKCPPQIAHLEEGFVVKYFRDYETDFDLEYISRGQKTAETDAYCGRYSLKNPA
VLFDSADAKPNKLPYGDILLFPYNQLCLAYKGFLANYIGLKFHYQDNGKITRSTDMQFTY
NFAYGNNWTYTCIDLLDLIQAKHSGTSFSLQRISLQKASESQSFYVDVVYIGQTPTLSTF
NEMPKRRLAALANKGIFLEHFQVNQTRINGSTMIVQYFVTMTSYNCSYNIPMMAVNFGQK
ITNEIETESVYRGINWPGESKIRIQRIQEASPPISGSFDIQAYGHTLKGIPAAVSAADLQ
FALQSLKEMGKVSVTREGTCAGYTWNIKWRSTCGKQNLLQMNDSNITGVKANITVAKIKE
GGLLRQHILGDLLRVPSQQPQVEVYVNGIPAKCSGNCGFTWDPMTTPLVLATRPSQGSFE
ESTILTIVGSGFSPSSAVSVSVGPTCCSILSVNENEITCQIRNGSAGRVPVTVSIADAGL
AQHAEGEGFYFIYQSQISHIWPDSGSLAGGTLLTISGFGFSESSEVLVGNETCKVIEGDT
NRITCRTPKRTEGTVDISVTTNGIQATAKDVFSYSCLQTPVITDFNPKVRTILGDVNLTI
KGYNFGNELAQNMVVHVGGKTCQVLSWNVTGIQCRLPLLPPGKHDIYVEVRTWGFASTRD
KSNASIQYILEVTHMFPQRGSLYGGTEITVKGFGFSTIPTENTVLLGTFPCNVTSSSESI
IRCTLHSTGNVFRITNNGDNLEHGFGYAWSPSVLNVSVGDTVIWYWQAHPFLKGIGYRVF
SVSSPGSIIYDGKGFTNGRQKSQSGSFSYRFTSPGTHYYSSGYIEESHSISLQGVINVLP
AETRHVPLQLFVGGMEATYAQGGPENLHLGSSVAGCLATDPLCGLNNTMAEHSNRLLFEL
SSCMSPCISNITPSSGTANELITIIGHGFSNLTCANKVTIGSYPCIVKESNNTSIICHID
PQNSMDVGIRELVTLIVYNLGTAINTLFNEFDRRFVLLPNIDTVLPNEGSTTGMTRVTIY
GSGFTGSSEGVEVFMGRFPCKVLTVNYTAIECESPPASEQRVHVDVLIHGEPARCQGTCS
FSYLESLTPYITGVFPDSIVGSAKVLVEGKGFGTVLEEISVFIGNQQFRVVDVTEKNLTV
LLTALPAGLHSLRVVVRSKGLALGNGTISSPAVASVQPASGSMGGGTALLITGNGFYPGN
TTVTVGEDPCQILLVNSSQIYCKTPAGEAGVANLKIWVNTVIYPPLPFTYASEDTPLLRG
IIPNRGPPGTEIEITGSNLGTDISEISVMINDVQCNVTMVNDTVLQCLVGAHEGGVFPVM
MHHKTRGSAISTVVFEYPLQIQNIHPRQGSFGGGQTMTVRGTGFNPQNSILLVCGSECVI
DRLRSNSTALFCEIPPNNGPGPEQACEVRVVNGQDSSPSSTLFTYSMSVTPLITEVFPSR
GSTAGGTSLTVMGSGFSENIQITIAGARCDIQYSNKTHIICLTTAHTPSGWAPVLLRDRN
MGMAKLENVDFLYVDVWSSNNSWGGVSPPEEGSLAVITKGQIILLDQSTPILKMLLIQGG
TLIFDEADIELQAENILITDGGILQIGTEASPFQHKAIITLHGHLRSPELPVYGAKTLAV
REGTLDLHGLPVPVVWTRLAHTAKAGEQTLILQQAVTWKAGDSIVIASTGHRHSQRENEK
RIIASVSANGVNITLSEPLNHTHLGITITLPDGTPFEARAEVGILTRNIIIRGSNNVEWN
NKIPACPEGFDTGEFATQTCLQGKFGEELGSDQFGGCIMFHAPLPNSDMVTGRIEYVEVF
HAGQAFRLGRYPIHWHLLGDLQFNSYVRGCAIHQTYNRAVTIHNTHHLLVERNIIYDIKG
GAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAAAGGTHFG
FWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGLWIFEEYFPMQTGSCTSTVP
VPAIFHSLTTWNCQKGAEWVNGGALQFHNFVMVNNHEAGIETKRILAPYVGGWGETNGAM
IKNAKIVGYLEELGLGSAFCTSRGLVLPFSEGLTVSSVHFMNFDRPTCVALGVTSITGVC
NDRCGGWSTKFVNIQYFHTPNKAGFRWEHEALLIDIDGSLTGHKGYTVIPYSSLLDPSHC
TQEAQWSVGFPGSVCDTSVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSVVPFQKKRLTHM
SGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKEEDYVIISHNFTQNPDMFNVIDMR
NGSSNPLNWNTSKNGDWHLETNTSTLYYLVSGRSDLQQSQLTSGTLDPNVKDVIINFQAY
CCILQDCFPVHPSSRKPVPRKRPTTYNLWSNDSFWQSSPENNYTIPHPGASVIIPEGTWI
VADTDLPSMERLIVWGVLELEDKSKVGTAGPSYRRVVLNATYISVQGGRLIGGWEDNPFK
GELQIVLRGNHTTPEWALPEGPNQGAKVLGVFGELDLHGLPRSIYKTKLSETAEAGSKVL
SLVDAVDWQEGEEIVITTTSYDLHQTETRSIVKILHGHKILILNDSLSFTHLAERYHVPE
TGQSYTLAADVGILSRNIKVIGEDYPGWSKDSFGARILVGSFMGNMMTFQGNARISNVEF
YHSGQEGFRDSTDPRYAITFLNLGQVQEHGLSYVRGCSFHHGFSPAIGVFGTDGLDIDDN
IIHFTVGEGIRIWGNANRVRGNLVTLSVWPGTYQDRKDLSSSLWHAAIEINRGTNTVLQN
NVVAGFGRAGYRIDGEPCSSQSNPMEDWFDNEAHGGLYGIYMNQDGLPGCSLIQGFTIWA
CWDYGIYFQTTESVHIYNVTLVNNGMAIFSMIYMPAAVSHKISSKIIKIKNSLIVGSSPE
FNCSDVLTNDDPNIELTATHRSSRHPSGGRSGICWPTFASAHNLAPRKPHAGIMSYNAIS
GLLDVSGSTFVGFKNVCSGERNVIFITNPLNEDLQHPVHVKKIQLVDSTEQSKIFIHRPD
ISKVNPSDCVDMVCDAKRKSFLRDMDGSFLGNSGSVIPQAEYEWNGNKQLGIGDYRIPKV
MLTFLNGSRIPVTEKAPYKGIIRDSTCKYIPEWQSYQCFGMEYAMMVIESLDSDTETRRL
SPVAIVSNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNQSYEVYFTGTSPQNLRLM
LLNVDQNKAVLVGIFFSTLQRLDVYVNNSLVCPKHTVWDTQKKHCKLNRHLRTGQFLPNL
DSTVGENYFDKTYQMLYLLVKGTIPIEIHTATVIFVSFQLPGVTEDDFYISQNLVRNLAL
FLKIPSDKIRVTRIIGGESLRRKRSMRHTIEVEIGEAPTQLLPNDTTGHMQLSELQETAA
SLGQAVILGKISSILGFNVSSMSITTPIPRPSDSGWTKVTAQPVERSAFPVHHVAFVSSL
LVITQPVAAHPGQPFSQQPSVKATDSNGNCISVGITSLTLKAILKDANNNQVSGLNGNTT
IPFSSCWANYTDLTPLRIGKNYKIEFLLDNNIRVESRAFSLTAQSISGGGGGSSSSSGSS
SSSSHNEASTVRPSVHILTIVMSCLMGRVLLLEIFMATVFILNMIAGDN
Download sequence
Identical sequences A0A1S3EU22
XP_012867923.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]