SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3EUB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3EUB6
Domain Number 1 Region: 382-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 415-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000597
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3EUB6
Sequence length 479
Comment (tr|A0A1S3EUB6|A0A1S3EUB6_DIPOR) Krueppel-like factor 10 {ECO:0000313|RefSeq:XP_012868006.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Klf10 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MLNFGASLQQAAEERMEMISERSKESMYSWNKTTEKSDFEAVEALMSMSCSWKSGFKKYL
ENRPVTPASDTSEEESLLPGTPDFHAIPAFCLTPPYSPSDFEPSQVSNLMAPAPPTGHFK
SFSDPAKPTVPVPFKEEQNPVSTPKLPKAQATSVIRHTADAQLCNHQSCPVKAAGILNYQ
DNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNAVADADEKAGVPRYDFSVPSSETVIC
RSQPAPASPQQKSVLVSPPAVPTGGMSPLPVICQMVPLPANNPVVTTVVPSTPPSQPPAV
CPPVVFMGTQVPKGAVMFVVPQTVVPSPKPPVLSPNGTRLSPIAPAPGFPPSAAKVTPQI
DSSRVRSHICSHPGCGKTYFKSSHLKAHMRTHTGEKPFSCSWKGCERRFARSDELSRHRR
THTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPSVPAPNQ
Download sequence
Identical sequences A0A1S3EUB6
ENSDORP00000014372 XP_012868006.1.60039 ENSDORP00000014372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]