SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3EXV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3EXV4
Domain Number 1 Region: 42-207
Classification Level Classification E-value
Superfamily PR-1-like 1.31e-38
Family PR-1-like 0.00034
Further Details:      
 
Domain Number 2 Region: 310-441
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-27
Family C-type lectin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3EXV4
Sequence length 452
Comment (tr|A0A1S3EXV4|A0A1S3EXV4_DIPOR) C-type lectin domain family 18 member A-like {ECO:0000313|RefSeq:XP_012868272.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=LOC105983069 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MLQPEFSLGMGGQGHGPGLLTVLLGLLGINWAQGQPLQLPEQTAVIGALSRKESFLLLSL
HNRLRSRVQPPAANMQRLDWSESLAHLAQARAALCGTPAPSLASAPQRAPHVGWNMQLLP
AGSASFVEVVSLWFAEGQQYSHIATECAHNATCTHYTQLVWATSSQVGCGWHLCSAGHAV
MEAFVCAYSPGGNWELDGKTIAPYKKGAWCSLCTASLSGCFKAWDHAGGLCEVPRNPCRV
SCRNNGRLNISTCRCLCPPGYTGRYCQVRCSMQCVHGRFREEECSCICDVGYGGAQCATK
VHFPFHACDLRIDGDCFMVSSEADTYYGAKMKCQGKGGVLAQIGSQKVQDILAFYLGHLE
TTNEVTDSDFETRNFWIGLTYKMAKDSFRWATGEHQVFTSFAFGQPDNQGFGNCVELQAS
TAFNWNDQRCKTRNRYICQFAEEHISRWNPGP
Download sequence
Identical sequences A0A1S3EXV4
XP_012868272.1.60039 ENSDORP00000003835 ENSDORP00000003835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]