SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3FCS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FCS8
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 1.76e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  A0A1S3FCS8
Domain Number - Region: 36-101
Classification Level Classification E-value
Superfamily DNA clamp 0.027
Family DNA polymerase processivity factor 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FCS8
Sequence length 281
Comment (tr|A0A1S3FCS8|A0A1S3FCS8_DIPOR) cell cycle checkpoint protein RAD1 isoform X2 {ECO:0000313|RefSeq:XP_012874065.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Rad1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MPLLAQGLPDDEEQYCLVASLDNVRNLSTILKAIHFREYATCVATDNGIRVTVENAKCVQ
ANAFIQADIFREFMIKEESVTFRINFTVLLDCLSIFGSSSMPGTYTALRMCYQGYGHPLI
LFLEEGGVVTVCKINTQEPEETLDFDFSSTNVINKVILQSDGLREAFSELDMTSDVFQIT
MSPDKPYFRLSTFGNGGSSHLDYPKDSDLMEAFHCSQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEVSESES
Download sequence
Identical sequences A0A1S3FCS8
ENSDORP00000008804 ENSDORP00000008804 XP_012874065.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]