SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3FGR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FGR6
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 2.06e-19
Family G-type lysozyme 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FGR6
Sequence length 194
Comment (tr|A0A1S3FGR6|A0A1S3FGR6_DIPOR) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Lyg1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MSALWLLLGLLALTCSSESSNWGCYGNIRTLNTPGASCGIGRRHGLTYCGVRASERLAEI
DMPYLLRYQPMMRTIGRRYCVDPAVIAGVLSRESQGGNILVNVGDGDRMVQDSSFYPSPS
WINESQISQATQLLTARIKDIQTRFPTWTPGQYLRGGLCSYSGGPGFVKSSHDLSCDFCN
DVLARAKYFKQHGF
Download sequence
Identical sequences A0A1S3FGR6
XP_012875239.1.60039 ENSDORP00000005969 ENSDORP00000005969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]