SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3G818 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3G818
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-53
Family APC10-like 0.0000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3G818
Sequence length 185
Comment (tr|A0A1S3G818|A0A1S3G818_DIPOR) Anaphase-promoting complex subunit 10 {ECO:0000256|PIRNR:PIRNR028841} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Anapc10 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNLKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences A0A1S3G818
ENSDORP00000015700 ENSDORP00000015700 XP_012884968.1.60039 XP_012884969.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]