SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GAY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1S3GAY4
Domain Number - Region: 233-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 105-224
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.04
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number - Region: 364-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0477
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 233-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0643
Family Growth factor receptor domain 0.0027
Further Details:      
 
Domain Number - Region: 623-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GAY4
Sequence length 1027
Comment (tr|A0A1S3GAY4|A0A1S3GAY4_DIPOR) platelet endothelial aggregation receptor 1 {ECO:0000313|RefSeq:XP_012885986.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Pear1 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MLPSLCPLLLLLALDLRLARTLNSNDPNACTIWESFTTTTKESHSRPFSLLPTESCERPW
EGPQACPQPTVVYRTVYRQVVKMDYRPRLQCCQGFYESSGACVPLCAQECVHGRCVAPNE
CQCVPGWRGTDCSSECAPGMWGLKCDKPCLCGNSSSCDPKSGVCSCPSGLQPPNCLQSCS
PGHYGPACQFSCQCHGAPCDPRTGACFCPPGRTGPSCDVTCLPSTDGFFCPSISPCQNGG
VFLTSQGSCSCPPGWMGTICSLPCPEGFYGPNCSQECHCHNGGFCDRFSGQCHCAPGYTG
ERCREECPVGRFGQDCAEVCDCALGARCFPANGACLCEHGFTGDRCTERLCPDGLYGLNC
QTACSCDPEHSLSCHPMHGECSCRPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCLAD
SGLCRCAPGYTGPHCASLCPPDTYGANCSARCSCENAIACSPIDGTCVCKEGWQRGNCSV
PCPPGTWGFGCNASCQCANEGICSPQTGACSCTPGWHGAYCQLPCPKGQFGKDCASHCDC
EHADSCEPIHGHCQCQAGWMGTRCHLPCPEGFWGANCSNTCTCKNGGTCIPENGNCVCVP
GFRGPSCQRSCQPGRYGKRCIPCRCNNHSSCHPSNGTCYCLAGWIGPDCSQQCPSGHWGA
KCAQICQCHHGGACRPQDGSCVCTPGWTGPHCMEGCPLGMFGANCSQSCQCGPGEKCHPE
TGACVCPPGHSGAPCRIGSLEPFTMMPTSPVAYNSLGAVIGIAVLGSLVVALVALFIGYR
QWQKGKEHQHLAVAYSTGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPNPPPPNKVP
GSQLFASGAHGHDNLATLPADRKHRREPPPGPLDRGGSLPDRSYSYSHSNGPGPFCNKGP
ASKEGLGASMASLSSENPYATIRDLPSLPAGLRESSYVEMKGPPSGSPPRQPLQLPDSLR
RQQRDSGTYEQPSPLTHDQDSLGSQPPLPPGLPPGHYDSPKNSHIPAHYDLPPVRHPPSP
PRQLQDR
Download sequence
Identical sequences A0A1S3GAY4
ENSDORP00000012099 ENSDORP00000012099 XP_012885986.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]