SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GHE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GHE1
Domain Number 1 Region: 21-181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-45
Family Dual specificity phosphatase-like 0.0000000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GHE1
Sequence length 185
Comment (tr|A0A1S3GHE1|A0A1S3GHE1_DIPOR) dual specificity protein phosphatase 3 {ECO:0000313|RefSeq:XP_012887427.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Dusp3 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MSGPFDLSVQDLNDLLSDGTGCYSLPSQPCNEVTPRIYVGNATVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAHKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVRSAVSIVRQNREIGPNDGFLAQLCHLNGRLIRE
GKLKL
Download sequence
Identical sequences A0A1S3GHE1
ENSDORP00000014212 XP_012887427.1.60039 ENSDORP00000014212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]