SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3GZZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3GZZ0
Domain Number 1 Region: 108-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.67e-47
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 2 Region: 432-477
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000183
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3GZZ0
Sequence length 571
Comment (tr|A0A1S3GZZ0|A0A1S3GZZ0_LINUN) ankyrin repeat and SOCS box protein 16-like {ECO:0000313|RefSeq:XP_013379317.1, ECO:0000313|RefSeq:XP_013379318.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106150852 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MPTQTGKTATAVRPKTATQREKSVKTTTSTAKTSKVTDKTSVSAKKLEPNGEVVKGTEGI
NPSKTQHVRDDSTQVTGDINKEDATQVQEGGIARKKPPVQPPKATEFFKLIHEGNHRKLK
ILLRKRDVDVNWVDKNDPLQPPGILLACEKNNLEVAKVLLQPGNKMIPDVNLEDKKGKRA
VWWAAMHGNAELVDQLLIHDCDVDILDKESGTTPLYRAILSNSAKVCQLLIHAGANVNLR
ILGFNVGGESPLMKCVQLDNKEICEVLINSLCNLNAKTDTRYNALHYAVAYRRYDIAELL
LTNRIHMHTASVEGVTPMTIAVDQHNAAMCRILVEFGYNMQKKYKWGETPLQHAIKIHSE
NCAITLVHMGCKLKRPKEENSYFYLAASEGLFQLMKLLLEINPYYIYEKWILERNLPLSL
YQKPELFEWLFAKSSQPASLSALCRSVIRVAIGPYPSTQVLDLPLPKKLQEYLALNEYVN
EEMYKKIPLTKKECPFDCPSYCPVTARKCPFLDIEGIDYVDSDEEEEEESCAGHGTKDGH
LESPKVKSIINSKEKDALKRGGTPRRVSFKT
Download sequence
Identical sequences A0A1S3GZZ0
XP_013379317.1.76062 XP_013379318.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]