SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3HM43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3HM43
Domain Number 1 Region: 85-173,202-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-52
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 417-462
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000366
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3HM43
Sequence length 494
Comment (tr|A0A1S3HM43|A0A1S3HM43_LINUN) ankyrin repeat domain-containing protein 61-like {ECO:0000313|RefSeq:XP_013387168.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106156459 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MFLIRHTNNGNQQVGPQFPPYLPATRLRRQENNSSFGSQISSWWRSLLSRRRARVTGTVF
YSYEPFMTNYQRSRGKHLPMRVKVYDAIIRNDLGLLRELLQDEDYDPNKLTSFSPDDTED
SLLPVMQTLPLHVACIYRRPDAMKMLLEHGAKVDTVDWAGRTPLEMVIVYWPRVPCDEEV
DPKSSDDQFQTYLREQHMLSINCLRLLMQYGADIQAKVSRPILNRHGQSFLHCTAQNTLP
LAAEWLIRYGADIEARDAEGRTPLITAAKLPCLKVAELLMSLGADPSAQDNHGHAPLHYL
VYRGRDHLIRLALELGADPNATNDDQLTPLHVAAEIGNSQAVRVLLLYGANPDIRDKKGR
TAIFCILDDVVNATDGARLGISLLLKETLYMKVVDKNGNLAKLLNNPRLVHLRDSLIQYT
REPPTLLKICRMKIRRSIGLRNISATNVAVLPLPTAFKRYIFSPWCAYCRRCECYRPNHP
KTKARELHLRIPAP
Download sequence
Identical sequences A0A1S3HM43
XP_013387168.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]