SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3JAT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3JAT4
Domain Number 1 Region: 37-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000021
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000341
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 74-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000787
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3JAT4
Sequence length 150
Comment (tr|A0A1S3JAT4|A0A1S3JAT4_LINUN) fibropellin-3-like {ECO:0000313|RefSeq:XP_013407306.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106171481 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MDWCVGDPCLNGGVRINNETTYQCICPTGFHGENCTEINWCAGNPCHNGGVCINNETTYQ
CICLPGFQGKHCDQMNWCAGDPCLNGSVCINNETTYHCICPPGFHGMNCDQIDWCVDDPC
LNGGVCINNETTYQCICPTGFHGKDCDQIS
Download sequence
Identical sequences A0A1S3JAT4
XP_013407306.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]