SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3K525 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3K525
Domain Number 1 Region: 148-338
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-32
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 370-415
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000235
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3K525
Sequence length 508
Comment (tr|A0A1S3K525|A0A1S3K525_LINUN) ankyrin repeat domain-containing protein 1-like {ECO:0000313|RefSeq:XP_013417730.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106178911 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MDVQQKIEDIETASLFSSLSTSSTEARLKAKAKRMAIEAELASFEVKKHLDEQELKLKQQ
REKLKLDTERAKLLAEETAYAEAEMETSAPISSTKLDIQVNSTNLTQNQSSHDVIHHLVN
SIQIPKVEIDKFDGDPLQYWNFIKTFENSTTPLYRAILSNSAKVCQLLIHAGANVNLRIL
GFNVGGESPLMKCVQLDNKEICEVLINSLCNLNAKTDTRYNALHYAVAYRRYDIAELLLT
NRIHMHTASVEGVTPMTIAVDQHNAAMCRILVEFGYNMQKKYKWGETPLQHAIKIHSENC
AITLVHMGCKLKRPKEENSYFYLAASEGLFQLMKLLLEINPYYIYEKWILERNLPLSLYQ
KPELFEWLFAKSSQPASLSALCRSVIRVAIGPYPSTQVQDLPLPKKLQEYLALIEYVNEE
MYKKIPLTKKECPFDCPSYCPVTARKCPFLDIEGIDYVDSDEEEEESCAGHGAKDGHLES
PKVKSIINSKEKDALKRGGTPRRVSFKT
Download sequence
Identical sequences A0A1S3K525
XP_013417730.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]