SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3KUR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3KUR1
Domain Number 1 Region: 526-894
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.19e-127
Family Hect, E3 ligase catalytic domain 0.00000000392
Further Details:      
 
Domain Number 2 Region: 21-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-29
Family Synaptotagmin-like (S variant) 0.072
Further Details:      
 
Domain Number 3 Region: 470-509
Classification Level Classification E-value
Superfamily WW domain 0.000000000000121
Family WW domain 0.00025
Further Details:      
 
Domain Number 4 Region: 183-224
Classification Level Classification E-value
Superfamily WW domain 0.000000000000348
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 344-383
Classification Level Classification E-value
Superfamily WW domain 0.00000000000334
Family WW domain 0.0019
Further Details:      
 
Domain Number 6 Region: 423-458
Classification Level Classification E-value
Superfamily WW domain 0.0000000000459
Family WW domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3KUR1
Sequence length 901
Comment (tr|A0A1S3KUR1|A0A1S3KUR1_SALSA) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106562216 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MSMAALPEVRGLQTDENEARILRVKVIAGIGLAKKDILGASDPYTRVSLYDPVNGELTSL
QTKTIKKTLDPKWNEEFFFRVHPRKHRLLLEVFDENRLTRDDFLGQVDVPLHQIPTENPN
IERPYTFKDFLLHPRSHKSRVKGHLRLKMTYLPKNNSEDAAEQTEDMDPSWEFLEGQDMS
GPRHNHLLPAMPPGWEERQDNLGRTYYVNHETRTTQWHRPIVQDSQVEAEQRQNIHMEAQ
QSFTARRQISDQEDSNDRQESPESWEIITEDESTFYNSQRSPPPPHSPLEFHSFCDELSR
FQASGATSGNRRTSLQLQGPSSHSSRRGSAQTLTVEEHPVHPVLLATSAGLPPGWEEKQD
SKSRPYYVNHNSRITTWTRPLIQITSEAAAQAVLSQNATVYQPPMLSPEGSPQHSPGSQR
ECGFMPAGWEVRNAPNGKPFFIDHNTKTTSWEDPRLKIPVHMRRRPSLDPTDLGPMPPGW
EERVHSDGRIFYIDHNTKNTQWDDPRLQNSAITGPAVPYSRDYKQKYEYFRKKLKKPADI
PNRFEMKLRRNAVLEDSYRRILSIKRADFLKARLWVEFEGEKGLDYGGVAREWFFLISKE
MFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRP
FYKMMLQKPITLQDMESVDSEYFNSLKWILENDPIDLDLRFTIDEELFGQTHQHELKPGG
SEIVVTDDNKKEYIHLVMQWRFVNRILKQMTAFKEGFYELIPQDLIKIFDENELELLMCG
LGDVDVNDWRENTKYKNGYCPNQPVILWFWKTVLLMDAEKRIRLLQFVTGTSRVPMNGFA
ELYGSNGPQLFTIEQWGTRDKLPRAHTCFNRLDLPPYESFEELREKLHIAIENAQGFDGV
D
Download sequence
Identical sequences A0A1S3KUR1
XP_013982418.1.97760 XP_013982419.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]