SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3L6Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3L6Z2
Domain Number 1 Region: 479-613
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-25
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 249-345
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 431-484
Classification Level Classification E-value
Superfamily BPTI-like 3.26e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 4 Region: 367-426
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000468
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.028
Further Details:      
 
Domain Number 5 Region: 167-217
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000901
Family Ovomucoid domain III-like 0.041
Further Details:      
 
Domain Number 6 Region: 74-123
Classification Level Classification E-value
Superfamily Elafin-like 0.000000051
Family Elafin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3L6Z2
Sequence length 620
Comment (tr|A0A1S3L6Z2|A0A1S3L6Z2_SALSA) WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein-like {ECO:0000313|RefSeq:XP_013986259.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106564618 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MDDFHETFLFKMNISSLSRRGVGGGKNVDTNQPKALIYPKGLLSGRVGWSSLVFLVCLCV
FPQQTWSASLAGSKVEHPGVCPNKLNANLWVDAQSTCERECEVDEDCAGIEKCCTNVCGL
FSCVATRFSDGTPAHPDGQGGGEKGSGGQGSIATCQGFICSQQGATCDIWEGQPICKCQD
HCEKDPSFTCASNGLTYFNKCYMDAEACTQGVMLTVVTCRFHLSGPQTSPLPEDTTANPT
LTSFLEDPIPPTLFSNPSHQSVYIGGTVSFHCDVMGVPRPVVTWEKQSDRHESLVMRPDR
MYGNVVITNIGQLVVYNAQVWDTGIYTCVARNAAGVLRADYPLSVIRRTEDDIFSEDHEM
AGMPMGPPFSPADCLAEVDRRECSTERHVDWYYDAEQGTCLAFSNGGCDDSRNRFETYEE
CQASCQREGMGICSLPAVQGPCKSWEAHWAWNSLLKQCQAFAYGGCQGNGNRFQSKKECE
ANCPQSKRRACKTCRVKGKIVPSLCRSDFAIVGRLTELIEDLDSGIARFSLEKILRDEKM
GLAFFNTRHLEVTLAKMDWSCPCPNITMEEGPLLVMGDVQDGMAVIQPNSYVRPISDKRL
KRIHEVLEKRTCEMLQRFRD
Download sequence
Identical sequences A0A1S3L6Z2
XP_013986259.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]