SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3LT49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3LT49
Domain Number 1 Region: 104-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 45-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 560-602
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 503-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000576
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3LT49
Sequence length 602
Comment (tr|A0A1S3LT49|A0A1S3LT49_SALSA) complement component C9 {ECO:0000313|RefSeq:XP_013994122.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=c9 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MRSEVAAALLLGFCAVAVSVSVSGDENRTGKRDTREVKVAPPDPVDCVWSLWSEWTPCNS
CTKIQHRSRSVEVFGQFGGKPCQGQPIGEQQACTIDAVCEQALPPECSSTEFTCESGACI
KLRLSCNGDYDCEDGSDEDCEPVRKPCGTKLYDTNEQGRTAGYGINILGMEPRINPFNND
YFNGMCNKVKNTNNNEYNRLPWNVGLLNYETIAEETVSKEIYEDTYTLLRELMTETKLTV
SAGLNLKFTPTEKSMAKSNTTVSGGVGLDAEYDRTQMIKEVSEYSTIKNKSFMRVNGHVQ
LSTYRMRSRDLQVAGEFLEHVKSLPLEYEKGQYFSFLEDYGTHYTRNGKSGGEYQLIYVL
NQDTIKDKKLTERKLQDCIKVGISGNFDTNIGIGGDAHIRPGYCKDTVNKNTDEKEGKAL
VDKVITVVRGGTLETAVAMRTQIMKEGLVDINTYQNWARTVGDAPALLSSEPEPIQTLIP
LSMPDANTRRLNMQRATQEYEAEYSVCKCKPCHNGGTLALLDGKCLCLCLPQFEGLACQD
AKADNNKNTKTPVESVPQEGNWSCWAAWSGCSGGKRIRTRSCNTQGLSGATCSGDTVAED
YC
Download sequence
Identical sequences A0A1S3LT49
XP_013994122.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]