SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3PVE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3PVE0
Domain Number 1 Region: 491-655
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.18e-70
Family A middle domain of Talin 1 0.00000032
Further Details:      
 
Domain Number 2 Region: 1809-1999
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.08e-50
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.92e-50
Family I/LWEQ domain 0.00000265
Further Details:      
 
Domain Number 4 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.09e-47
Family I/LWEQ domain 0.00000616
Further Details:      
 
Domain Number 5 Region: 1353-1487
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-45
Family VBS domain 0.00000937
Further Details:      
 
Domain Number 6 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-31
Family Second domain of FERM 0.00000125
Further Details:      
 
Domain Number 7 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-23
Family Third domain of FERM 0.0000182
Further Details:      
 
Domain Number 8 Region: 982-1069
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000693
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 9 Region: 1209-1329
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000847
Family VBS domain 0.025
Further Details:      
 
Domain Number 10 Region: 1519-1646
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000157
Family VBS domain 0.031
Further Details:      
 
Domain Number 11 Region: 1102-1174
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000785
Family VBS domain 0.06
Further Details:      
 
Domain Number 12 Region: 82-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000792
Family Ubiquitin-related 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3PVE0
Sequence length 2026
Comment (tr|A0A1S3PVE0|A0A1S3PVE0_SALSA) talin-2-like {ECO:0000313|RefSeq:XP_014031652.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106587616 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MVALSLKICVRQCNLVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILDYKKKQRPLKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVMEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVEETETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
AGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGNEKKIFQDHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVEEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNLVGRVEHGSVALPGVIRSGSIGTESLSMGTMPSAQQQVIM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQQAQADLGEVDNLPPLGQDMASKVWIQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
IEDDTGGSNDLMGAARNLAGAVSDLLKAVEPASGEPRQTVLSAAGSIGQASGDLLLQMGE
NESDERFQEVLMNLAKAVANAAAMMVLKAKNVAQVADDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVQACLSATVDGEMLKQVSAAASVVGQA
LGDLLEHVCHYASHGEPIGRYDQATDTIMTVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEVEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDRQQRLREAAEGL
RVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSASY
LVGVSDPNSQAGHQGLVDAIQFARANQAIQMACQNLVDPDSSPSQVLSSATIVAKHTSAL
CNACRLASSKTANPTAKRHFVQSAKEVANSTANLVKTIKALDGDFSQENRNTCLVATAPL
IEAVENLTAFASNPEFASVPAQISNEGSAAQEPILQSARSMLNSSTHLLKTARSLVINPK
DPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDYSIDNINGCIRNIEQASLAAVSQ
NLASRDDISLEALQEQLTSTVQEIGYLIDPISTAARGEAAQLGHKVTQLAGYYEPLIRAS
VGVASKLQDHQQQMAFLDQTKTLAESALQMIYAAKEGGGNPKASHTHDAIAEAAQLMREA
VDDIMVTLNEAASEGGMVGAMVDSIAEAMGRLDEGTSPEPEGSFVDYQTTMVKYSKAIAV
TAQEMMTKSVTCPEELGGLASRVTTDYSQLALQGRLAAHTAEPQEIGFQIKAGVQELGHG
CIFLVQKAGALQITPSDSYTKRELIECARTVTEKVSMVLSALQAGNKGTQACITAASAVS
GIIADLDTTIMFASAGTLNAENDESFADHRENILKTAKALVEDTKMLVSGAASGQDRLAQ
AAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELIGATKCAAGKAA
DDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDVP
EKSTTPEEFIRMTKGITTATAKAVAAGNSARQEDVISTANLSRKAIFDMLTTCKQAAYHQ
EVNKDVRSRALLYGTECTTGYIDLLEHVLLVLQGPTAEQKQQLVFYSKRVAGAVTELIQT
AEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQIL
EAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAVDDGQWSQGLISAARMVAAATSN
LCEAANASVQGQASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRA
SDNLVRAAQKAAFHKADDDNVVVKTKFVGGIAQVRLQGSGRLHSDM
Download sequence
Identical sequences A0A1S3PVE0
XP_014031652.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]