SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3Q017 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3Q017
Domain Number 1 Region: 854-925,956-1184
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-84
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000704
Further Details:      
 
Domain Number 2 Region: 1147-1453
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.25e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000154
Further Details:      
 
Domain Number 3 Region: 24-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-39
Family MAM domain 0.00000617
Further Details:      
 
Domain Number 4 Region: 355-559
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-27
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 5 Region: 251-389
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000574
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3Q017
Sequence length 1464
Comment (tr|A0A1S3Q017|A0A1S3Q017_SALSA) receptor-type tyrosine-protein phosphatase U-like {ECO:0000313|RefSeq:XP_014033277.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106588628 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MYSGVILLMLVVGIYADMDQGPTAGCTFDEDSDPGLCEYKQGQEDDFDWQLMRTYNWPHT
APDLLRGSFMMVNSSQHAAGQRAHLLLRSLSENDTHCIQFSYFLYSRDGHSPGDLQLYIR
VNGGPWGSAVWNVSGSHGRQWHQVELAVSTFWPSEYQVVFEASVSAERRGYIAIDDILLL
NYPCLTEVLSTQRRNSVVVAASSIQRLSHKRLMATFQVEAERGEQDLYRCITESARGAAV
SNFAELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREIEYRASQSPWSET
HGVGSLTYKVWHLEPDTEYRISVLLTRPGEGGTGAPGPPLVSRTKCAEPMRALRGLTAIE
IQPRQLVLQWEPLGYNLTRCHTYSVSLCYRYSTPAGGSAGNNATVRECLSVERNQSHFTL
RDLPPFRSVHVRLALENPEGKKESREVTFQTEEDIPGGIVPESLTFTPLDDMIFLKWEEP
VEPNGVITQYEISYQGIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGTTYLVSVRAR
TAKGFGQTALTEITTNISAPVFDYEDVPAPLSESESTITVLLRPALGRGAPVSAYQVVVV
EEDGSRRIRRRRRRELGSGSDCFPVPASQVEAQSKGTPHYYTAELPPSSLPEATPFTVGD
NHTYNGYWNTPLDPSKNYLVFFQAISNFRGETRINCIRIARKAACKDHKRALEVSQHAED
MGLILGACAGGLVVLILLLGAIVIIIKKGRDFYSYSYYPRKKVALNKAAMSYRQEKTRKL
GSLDCSMTEQSTLQQDGHTANSFMDAHTCNTRNEQRSSVNESSSLLGGSPRRHCRRKSSP
YHTGQLHPAVRVADLLQHINQMKTGEGYGFKQEYESFFDGWDVTKKKDKTKGRHDSLLGH
DRHRVKLHSLLADPNSDYGNANYIDLLHKLRLSRMISCGNQIYCRGTYDIRINREGYQRS
NHFIATQGPKQEMIYDFWRMVWQENCFSIVMITKLVEVGRMKCCKYWPEDSELYGDIKIT
LLKTETLAEYTVRTFAMERRGYPAKHEVRQFHFTSWPEHGVPYHATGLLAFLRRVKASTP
PDAGPVVVHCSMGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYV
FIHDAILEACLCGETAIPVLEFALTYKEMLRVDSQSNTSQLREEFQTLNSVTPHLDVEEC
SVSLLPRNREKNRSMDVLPPDRALAFLVTTEGIAEGSNYINAALTDSFHRPAAFVVTPHP
LPGTTADFWRLVYDYGCTSVVMLNQINQSNSAWVRRGEPCLKYWPEPGLQQFGPMTVELL
SMTADDDVIIRLFRVQNIMRLQEGQLVLRHFQFLRWSPYRDVPDSKKAFLSLLAQVHNWQ
RECGEGRTIVHCLNGGGRSGTFCACTMLLEMIRHHSLVDVFYAVKTLRNSKPNMVETMEQ
YRFCYDLALDYLDALDCLSEIEVR
Download sequence
Identical sequences A0A1S3Q017
XP_014033277.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]