SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3TA74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3TA74
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.63e-31
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 212-320
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000346
Family Calsequestrin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3TA74
Sequence length 586
Comment (tr|A0A1S3TA74|A0A1S3TA74_VIGRR) dnaJ protein ERDJ3A {ECO:0000313|RefSeq:XP_014490658.1} KW=Complete proteome; Reference proteome OX=3916 OS=Vigna radiata var. radiata (Mung bean) (Phaseolus aureus). GN=LOC106753378 OC=Phaseoleae; Vigna.
Sequence
MRTRLVSTRVIIVASLCFLASMKLEAKTVDPYKVLGVDKNASQREIQKAFHKLSLQYHPD
KNKAKSAQEKFSQINNAYDILSDEEKRKNYDMYGDVNGNPGFPGGHPGYQGGHPGFQGGH
PGGRGGYTYFTEGGPGQSHFNFKSGGDWQGGSKSFSFSSGGSGGSNSFGFGLDDIFGSIF
GGGAGSQFGGFGSSANTEGTSTASPQRLTSINSRIYKKEIENAGMTWILLSYRPKSASKN
IQYFESTVEEVASTLQGAMKVGSINCDKEVSLCKELGMYPQNAPRIFVLSYKENEIGSLV
EYSGHLVAKNLKAFVQEHLPRFSKRTNLNNLDQFSTTAKLPRVLLLSTKKDTPVIWRVLS
GLFHKRIIFIDAQVDDVSDPRIKSLGVDALPSIVGWLPNGEKRVLKTGISVKDLKSAVLD
LSKMLDSFVEASKKEASAQAKKAQTDPDDGRIPLLSQSNFEALCGAKAPVCIIGAFRSSK
AREKLESILTLVSQKSLSRRPNGGSSSSRDSISYALLDAAKHQSFLKAFDKTGYKSSDKL
LIAYKPRRGKYSVYRDEMTIEEVENFVASVLSGDIPFRETSGKAVL
Download sequence
Identical sequences A0A1S3TA74
XP_014490658.1.7879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]