SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3WJ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3WJ73
Domain Number 1 Region: 232-506
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.54e-79
Family Mitochondrial carrier 0.0000684
Further Details:      
 
Domain Number 2 Region: 44-224
Classification Level Classification E-value
Superfamily EF-hand 4.88e-35
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3WJ73
Sequence length 515
Comment (tr|A0A1S3WJ73|A0A1S3WJ73_ERIEU) calcium-binding mitochondrial carrier protein SCaMC-2 isoform X1 {ECO:0000313|RefSeq:XP_016046184.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=SLC25A25 OC=Erinaceinae; Erinaceus.
Sequence
MVSSVLCRCVASPPPDAAAAASSSTASSPASVGDPCGGAVCGGPDHQLRLWSLFQTLDVN
RDGGLCVNDLAVGLRRLGLHRTEGELRKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
FKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTI
DWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGG
GAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGARSLWRGNGINVLKIA
PESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTG
QYSGMLDCARKILAREGVTAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYAINSAD
PGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFRQILRTEGAFG
LYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences A0A1S3WJ73
XP_016046184.1.11023 ENSEEUP00000008902 ENSEEUP00000008902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]