SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3WVQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3WVQ4
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.2e-35
Family SCAN domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 327-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3WVQ4
Sequence length 472
Comment (tr|A0A1S3WVQ4|A0A1S3WVQ4_ERIEU) LOW QUALITY PROTEIN: zinc finger protein with KRAB and SCAN domains 3-like {ECO:0000313|RefSeq:XP_016050400.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=LOC103127478 OC=Erinaceinae; Erinaceus.
Sequence
MARESKENETLESHPAEDQAGILMVKVEEEDASTLAAETGATHSLSPGPERLRQRFRGFR
YPEAEGPREALSQLSERCRLWLXPEMHSKEQILELLVLEQFLTILPGVLQRWVRKQHPES
GEEAVVLLEYLERHLDQQMSQVPTRDQGQELLSCNMAMWTPAGSQNTQFQLMKSLLKHDF
LEPQPLPERGGKIQSKNRDLSPDGEHPEQDEGQTQCPLGEDIAQISEQEARLQRKQKNAT
GGRRHYCHECGKSFTQSSGLTKHRRIHTGEKPYECEDCGKTFIRSSALVIHQRVHTGEKP
YACDECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHKIHTGEKPYQCY
MCGKSFRRNSHLLRHQRIHSDKSVQNPKPEETWECQGRKGGQEENAEVPMSYKCSECERS
FTQKISGSLTEPQKIHMDEKPYQCDACGKGFTRTSYLAQHQRSHVGKKGLSH
Download sequence
Identical sequences A0A1S3WVQ4
XP_016050400.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]