SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S3WX11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3WX11
Domain Number 1 Region: 55-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 2 Region: 263-377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 466-503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 176-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 220-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 427-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3WX11
Sequence length 772
Comment (tr|A0A1S3WX11|A0A1S3WX11_ERIEU) low-density lipoprotein receptor-related protein 3 isoform X1 {ECO:0000313|RefSeq:XP_016050842.1} KW=Complete proteome; Reference proteome OX=9365 OS=Erinaceus europaeus (Western European hedgehog). GN=LRP3 OC=Erinaceinae; Erinaceus.
Sequence
MEKRAVAGLEGAPGARAQLAVVCLVNIVLTGRLSSAVPALGEASISQSPLPTAACSGKLE
QHTERRGVIYSPSWPLNYPPGTNCSWYIQGDRGDMITISFHNFDVEESHQCSLDWLMLGP
AAPPRQEALRLCGSAIPAAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSCQA
DEFRCDNGKCLPGSWQCNTVDECGDGSDEGNCSAPVSEPPHSLCPGGTFPCSGARSTRCL
PAERRCDGSQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDT
QDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
ARARSAGHGFNATYQVKGYCLPWEQPCGSGGDVEAGDPGEQGCFSEPQRCDGWWHCASGR
DEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCI
FETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQ
EYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRR
QMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAAHTSQTVLGDGLLQPVPGGAP
DTPAPQTDTNSSGTAPGHVPEVGPSGLPASGQRDPQGQQGNKDRKVCRAPRGASPAPVDT
ACTAQDPHSPTPAASGTPGPQPPEPVAVCRSPPPPSSPTLEASDDDEALLVC
Download sequence
Identical sequences A0A1S3WX11
XP_016050842.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]