SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S4LT73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S4LT73
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.77e-33
Family Calponin-homology domain, CH-domain 0.0000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S4LT73
Sequence length 133
Comment (tr|A0A1S4LT73|A0A1S4LT73_IXOSC) Alpha-actinin, putative (Fragment) {ECO:0000313|VectorBase:ISCW018751-PA} OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=8050875 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
LTLLQYWLIGLRGLVQECQAMAERRGLKALELWCRRVTEGYRDVRVCDMSASWRDGLAFC
ALIHHFRPDLIDFDGLRKEEVLANNRLAFSVAEAQLGIPALLDAEDMLAHRDPDRLSVAT
YVSQFYQYFEGGQ
Download sequence
Identical sequences A0A1S4LT73 B7PLB0
ISCW018751-PA 6945.ISCW018751-PA XP_002434559.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]