SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S7QUY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S7QUY1
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.79e-51
Family Atu1826-like 0.00000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S7QUY1
Sequence length 225
Comment (tr|A0A1S7QUY1|A0A1S7QUY1_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:CUX42162.1} KW=Complete proteome OX=1183431 OS=Agrobacterium genomosp. 6 str. NCPPB 925. GN=AGR6A_Cc60370 OC=Agrobacterium tumefaciens complex.
Sequence
MPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRGFTT
LRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMR
RPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDSDKVAPEKDVNGLVEKLKTQKGILI
THRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEPAAKRIR
Download sequence
Identical sequences A0A024IYY0 A0A0D8KXJ7 A0A0L6K3R1 A0A0Q8FU60 A0A1S7NZB8 A0A1S7PI37 A0A1S7QUY1 A0A212QL98
WP_020012833.1.101302 WP_020012833.1.11911 WP_020012833.1.1392 WP_020012833.1.1453 WP_020012833.1.19567 WP_020012833.1.200 WP_020012833.1.21489 WP_020012833.1.52976 WP_020012833.1.53041 WP_020012833.1.54166 WP_020012833.1.54788 WP_020012833.1.70856 WP_020012833.1.83858 WP_020012833.1.85202 WP_020012833.1.87887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]