SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3C4R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3C4R3
Domain Number 1 Region: 216-387
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.16e-29
Family Glutathione peroxidase-like 0.00058
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.8e-28
Family PHBH-like 0.00021
Further Details:      
 
Domain Number 3 Region: 85-177
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-16
Family FAD-linked reductases, N-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1T3C4R3
Sequence length 388
Comment (tr|A0A1T3C4R3|A0A1T3C4R3_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:OPB36084.1} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0112500 OC=Trichoderma.
Sequence
MDIIPVTDFPDIRVRSMVRSTSGGSLMMIPRENKLVRLYIQLTDGLSTNSRLTRSMVTPM
MLIETAKRILSPYTIDFTYIHWWSAYQIGQRSGDHFDKQGRIFLAGDAVHTHSPKAGQGM
NVSMQDTYNLGWKIGLACKGLVRPKAIIPTYDMERKLVAKELIAFDRKFSELLSMHSAKD
ISETSVELKQFFKKAPLFTTGIGVNYASSILTVVDDEAHGLAKYVVPGKRFASCQVTNHS
DGRVWELHHRMPSDGRFRIMVFGGNIAHDEQRFAVNALGQWLGKTLIPRYPPINICPIVD
RRLQTVRFQSELMTPIIEIFLVHTAPRDQIDILQDVDSTYHPWHPKLGWDYDHIFTTSRV
ITEDTIQSTQSVYEDYGIDEERGAVVIA
Download sequence
Identical sequences A0A1T3C4R3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]