SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3CID9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3CID9
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 5.54e-22
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1T3CID9
Sequence length 97
Comment (tr|A0A1T3CID9|A0A1T3CID9_9HYPO) U6 small nuclear ribonucleoprotein (Lsm3) {ECO:0000313|EMBL:OPB40857.1} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0009380 OC=Trichoderma.
Sequence
MADVGEESSHVAEPLDLVRLLLNEVVFVKLRGDRELKGKLHAYDSHCNLVLGDVEETIYA
VDDDEEESDEVKTISRKSEMLFVRGDSVVLISPQVPF
Download sequence
Identical sequences A0A0F9XLP8 A0A1T3CID9
jgi|Triha1|99591|e_gw1.24.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]