SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3CPB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3CPB8
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.06e-22
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1T3CPB8
Sequence length 98
Comment (tr|A0A1T3CPB8|A0A1T3CPB8_9HYPO) U6 snRNA-associated Sm-like protein LSm2 {ECO:0000256|PIRNR:PIRNR016394} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0085520 OC=Trichoderma.
Sequence
MLFFSFFKTLIDHEVTVELKNDIQLKGILKSVDQYLNIKLDDIQVVEELKYPHLSSVKNV
FIRGSVVRYVHLPAASVDTQLLEDATRREAAAQQAKAK
Download sequence
Identical sequences A0A024SK37 A0A1T3CPB8 A0A2H2ZMM5 G0RE46 G9NDI6
jgi|Trire2|46320|estExt_Genewise1.C_41036 jgi|Trilo1|63348|fgenesh1_pm.1_#_327 jgi|Trive1|82509|estExt_fgenesh1_pm.C_70024 51453.JGI46320 XP_006963128.1.9351 XP_013949946.1.71794 jgi|Trias1|156922|estExt_Genewise1.C_1_t40406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]