SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3CTT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3CTT0
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.13e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1T3CTT0
Sequence length 83
Comment (tr|A0A1T3CTT0|A0A1T3CTT0_9HYPO) Small nuclear ribonucleoprotein {ECO:0000313|EMBL:OPB44466.1} KW=Complete proteome OX=1491466 OS=Trichoderma guizhouense. GN=A0O28_0027850 OC=Trichoderma.
Sequence
MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDEAVEEKDGGEKIRLGMVV
IRGNSVVMLEALERIGGDDRQNR
Download sequence
Identical sequences A0A024RW81 A0A0F9WU04 A0A1T3CTT0 G0REQ9 G9MKE5
XP_006963552.1.9351 XP_013959334.1.71794 jgi|Trilo1|7131|gm1.7131_g 51453.JGI21972 jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210 jgi|Triha1|439995|CE270146_10305 jgi|Trive1|32934|e_gw1.3.1916.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]