SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1T3VQU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1T3VQU5
Domain Number 1 Region: 207-246,289-362
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000458
Family SMI1/KNR4-like 0.018
Further Details:      
 
Domain Number 2 Region: 31-63,90-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000562
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1T3VQU5
Sequence length 366
Comment (tr|A0A1T3VQU5|A0A1T3VQU5_LYSEN) Uncharacterized protein {ECO:0000313|EMBL:OPD65893.1} KW=Complete proteome OX=69 OS=Lysobacter enzymogenes. GN=BV903_01180 OC=Xanthomonadaceae; Lysobacter.
Sequence
MAGSVLDWRVYGRAPSLDTFWDEAGNLGRAAAGADDIAAVQARLRIELPPWLRVLYARYD
GGAVRMARAAALHSEDWIDADWLVPRARLLPLAEWFSLAELRRREDYRDDAFAALAADDS
RLIAIALGEDNGTLCLDCSAGGEPRIVLTDQRQRLREYPDHTAFLADLVEIQYWNPALQA
RHDPRQRLRCDPRPPSLDTFWSGPGYWADAAAPADEAALAAAEARLGLRLPALLRALYLR
QDGGSTEFVWAPLRRQPSWHLYDWESVVPGDSVAALADLRTLADWAADFQGSDALYGFVR
NYAGCERLLILASHNIEWLLCLDYRERGPQQEPEVVYFEYFGELVANYRARDFHRFFADL
RRGELE
Download sequence
Identical sequences A0A1T3VQU5
WP_078995537.1.36467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]