SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7ETL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7ETL2
Domain Number 1 Region: 4-226,269-367,429-481
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.98e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 465-571
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.57e-33
Family Anticodon-binding domain of Class II aaRS 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7ETL2
Sequence length 578
Comment (tr|A0A1U7ETL2|A0A1U7ETL2_NATPD) Glycine--tRNA ligase {ECO:0000313|EMBL:CAI48255.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_0328A OC=Natronomonas.
Sequence
MSELETLTELAKRRGFFFSSNEAYGGTAGFYTYGPEGAALKRNLEDIWRDIFVRELGNME
LEAPTVMPEAVFEASGHLDGFDDMIIECPECGATHRADHLVEDEIEDIEDAEAYEPTEVA
ELIATHHIECPSCGESLAGESVEEFNLMFGTNIGPGSSAPGYLRPETAQGIFVEFPRLKE
YARNKLPFGVAQIGRAYRNEISPRRALVRVREFTQAELEHFIDPERDEPPIDRVADVELP
LYSVANQNAENGGVETYTVAEAVDSGIIESEWVAYYLGRSMDFYERIGIDMDRFRYRQHL
PGERAHYAADCWDAETELGGSWVEVTGFAYRSDYDLSKHGDYSKEEFTLFRQYDEPKTVE
RATVDPDMSYLGPEFGGAAGDIAAALESLAGRDRSAFDGDEVTVEVDGDEYTVPVERTGF
AVEEQTEAGEHITPHVVEPSFGVGRLVYSVLVHSHGTDTVDDEERTYLDLPAELAPTTVA
VFPLMTKDGLDDRAREVSETLREAGFEVAYDDTGNIGRRYRRQDEVGTPYCVTVDYETQE
DGTVTIRERDSTDQTRVPVEGLPAAIAELVDGATLAEL
Download sequence
Identical sequences A0A1U7ETL2
gi|76800818|ref|YP_325826.1| WP_011321893.1.57290 348780.NP0328A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]