SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7ETL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7ETL5
Domain Number 1 Region: 166-276
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.44e-27
Family Single strand DNA-binding domain, SSB 0.0036
Further Details:      
 
Domain Number 2 Region: 271-368
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.54e-18
Family Single strand DNA-binding domain, SSB 0.0063
Further Details:      
 
Domain Number 3 Region: 51-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000386
Family Single strand DNA-binding domain, SSB 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7ETL5
Sequence length 467
Comment (tr|A0A1U7ETL5|A0A1U7ETL5_NATPD) Replication protein A {ECO:0000313|EMBL:CAI48248.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_0314A OC=Natronomonas.
Sequence
MGAIEDIYEDLDADVSESEFREAVEAKVEQMGGLADEETAAMLIAHDLDGGEVETIADIE
PGLEEVKFLGKVASVGELRTFERDGEDDEDGHVLNLDVADESGTVRVALWDDDAVAADEE
VEPGQVFRIKGRPKDGYSGVEVSADRIEADEEAEIEVDLDGRTTADSLSMGQSDVTLRGV
VLDTDAVRTFDRDDGSEGRVSNLTLGDETGKIRVTLWDEQADRAEALEAGQSVEIVDGYV
REREGDLELHAGSRSDIDELDESVEFVPDATDIDSIAIDETVDIAGVVRSADPKRTFDRD
DGSEGQVRNVRLQDNTGDIRVALWGEKADLDVGPGDEVFCADVEIQDGWQDDLEASAGWQ
STVVVLDDDDPDRGGDSAGLDEFSGGSAAAHDGSDGSDPAADDEAASDAGDEPETVTGTV
VQPADPVILDNGDETIHVETDAEVHLGQEVTVRGRRDGERFVAEDVF
Download sequence
Identical sequences A0A1U7ETL5
348780.NP0314A gi|76800811|ref|YP_325819.1| WP_011321886.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]