SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7ETW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7ETW8
Domain Number 1 Region: 13-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-40
Family Extended AAA-ATPase domain 0.00038
Further Details:      
 
Domain Number 2 Region: 288-372
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-20
Family Helicase DNA-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7ETW8
Sequence length 374
Comment (tr|A0A1U7ETW8|A0A1U7ETW8_NATPD) ORC1-type DNA replication protein {ECO:0000256|HAMAP-Rule:MF_01407} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_0588A OC=Natronomonas.
Sequence
MADDDMLSWDESVFRDEGVLELDYLPEAFLHRDEQMETLKYALRPAVRGSRPLNVMARGP
PGTGKTTAVQKLFDELAGVGGVETVRVNCQVDSTRYAVFSRLFESLFEYEPPASGVSFNK
LFGQITNRLVEDDDVLVVALDDVNYLFYESEASDTLYSLLRAHESHSGAKIGVIVVSSDL
DLNVIEELDGRVQSVFRPEDVYFSAYGERAIADILSERVERGFREGAVSARVLDRVAEHT
ADSGGDLRVGIDLLRRAGLNAEFRGSTEVAVADVDTAYEKAKYIHLSRRLQGLSESEAAL
VRVLTDHDGERAGAVYEAFSEETELGYTRYSEIVNKLEQVGVVDAEYTNVDGRGRSRELS
LAYDADAVLERLEE
Download sequence
Identical sequences A0A1U7ETW8
348780.NP0588A WP_011322021.1.57290 gi|76800946|ref|YP_325954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]