SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7ETY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7ETY0
Domain Number 1 Region: 125-219,274-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-51
Family Extended AAA-ATPase domain 0.00093
Further Details:      
 
Domain Number 2 Region: 451-557
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-30
Family Helicase DNA-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7ETY0
Sequence length 571
Comment (tr|A0A1U7ETY0|A0A1U7ETY0_NATPD) ORC1-type DNA replication protein {ECO:0000256|HAMAP-Rule:MF_01407} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_0596A OC=Natronomonas.
Sequence
MTNDDTASEPRTQDRLERGSGDTDEDSEDTVDIDTDTEGSDDVATPSQSSGSPVETGGFS
EDESDSERTDSVPTGSEHARNVDGFSGDIDLEDLDLAPDDETEEDGEADEASRGLFDDLL
EGEPIFENKEVLRPSYTPHKLPHREEQINNMATILVTALRGETPSNILIYGKTGTGKTAS
AKFVSEELETTSQKYEVPCEVQYINCEVTDTQYRVLAQLANKFIEKNEAYIESRLDELEA
LRDRAAEDPAALDDTEFDSVAAVEAEIDTLETDLEEFDPVPMTGWPTDRVYSTFFDAVDY
HERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELSNSRVSIMGISNDLKFTDFLDPRVKS
SLGEEEIVFPPYDATQLRDILQHRAEIAFKPDTLSDDVIPLCAAFAAQEHGDARRALDLL
RTAGELAERDRTETITEKHVRKAQEKIELDRVVEVVRTLPTQSKLVLYATILLEKNGVHN
INTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGRYGRTKEISLSV
PLDETEAVLLSDSRVGEVEDAQPFVQARFDN
Download sequence
Identical sequences A0A1U7ETY0
gi|76800950|ref|YP_325958.1| 348780.NP0596A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]