SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EUK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EUK8
Domain Number - Region: 211-247
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00474
Family MarR-like transcriptional regulators 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EUK8
Sequence length 250
Comment (tr|A0A1U7EUK8|A0A1U7EUK8_NATPD) HTH domain protein {ECO:0000313|EMBL:CAI48662.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1142A OC=Natronomonas.
Sequence
MRSETELRPVQEVHVAPVGYEYDRIKRPALEYGADTLYLLRERERTELSYHDRLVTELTD
RGMTVRSREVDLDDMYDVLGEVTTIVHGHDGDIVRVNVSSGPKLSTVGAALACMATDASG
YHVHPETRAHPLDEQPRTEGMQFAEQLPSYPLETPTEDQVRVLDYIDRRDSETYTPKKSD
LIEFAEDEQLDFLTRSEPANDKAKFALLNNRILEPLSANGYVHIEPVGRTKQVSLTDTGE
NALRAFRHKL
Download sequence
Identical sequences A0A1U7EUK8
gi|76801223|ref|YP_326231.1| 348780.NP1142A WP_011322298.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]