SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EV09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EV09
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00131
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EV09
Sequence length 173
Comment (tr|A0A1U7EV09|A0A1U7EV09_NATPD) HTH domain protein {ECO:0000313|EMBL:CAI48821.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1460A OC=Natronomonas.
Sequence
MTSSDAPDWDFKERDVLVLRELSRDPQLSSRDLARILEEKYDIDVSHVTVSESIRGMREE
GVFREAVIPNEEYFHFALFEFKFNPENFDDGWRDAMEFIRDSPNTLFYFLSDGEYQWKSV
MMFSDREAQSQWIHQFYKEHGDIVHNLRNSVVTNVLKFRTDPEVLSSLHEGDE
Download sequence
Identical sequences A0A1U7EV09
gi|76801381|ref|YP_326389.1| WP_011322456.1.57290 348780.NP1460A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]