SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EV38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EV38
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000423
Family PF1790-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EV38
Sequence length 101
Comment (tr|A0A1U7EV38|A0A1U7EV38_NATPD) HTH domain protein {ECO:0000313|EMBL:CAI48855.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1528A OC=Natronomonas.
Sequence
MIDRLEKEVDMLERHLRVLRMVIENEPIGIVKMSNETGYPHHKVRYSLRVLEEENLIEPS
SQGAITTEDTIEFVEDLDSKVDDIIDKLEGMKIDDVPEIEG
Download sequence
Identical sequences A0A1U7EV38
348780.NP1528A WP_011322489.1.57290 gi|76801414|ref|YP_326422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]